Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UTP4 Rabbit Polyclonal Antibody (HRP)

UTP4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NAIC, CIRH1A, CIRHIN, TEX292

UniProt

Q969X6

Immunogen

The immunogen for Anti-CIRH1A antibody is: synthetic peptide directed towards the Middle region of Human CIR1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FAHHLELWRLGSTVATGKNGDTLPLSKNADHLLHLKTKGPENIICSCISP

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIST, CT, Control Peptide (PDZ Protein Interacting Specifically with TC10, CFTR-associated ligand, CAL, dJ94G16.2, Fused in Glioblastoma, FIG, Golgi-associated PDZ and Coiled-coil Motif Containing, Golgi Associated PDZ and Coiled Coil Motif Containing Pro
MBS610728-01 0.1 mg

PIST, CT, Control Peptide (PDZ Protein Interacting Specifically with TC10, CFTR-associated ligand, CAL, dJ94G16.2, Fused in Glioblastoma, FIG, Golgi-associated PDZ and Coiled-coil Motif Containing, Golgi Associated PDZ and Coiled Coil Motif Containing Pro

Sign In for Pricing
View Details
PIST, CT, Control Peptide (PDZ Protein Interacting Specifically with TC10, CFTR-associated ligand, CAL, dJ94G16.2, Fused in Glioblastoma, FIG, Golgi-associated PDZ and Coiled-coil Motif Containing, Golgi Associated PDZ and Coiled Coil Motif Containing Pro
MBS610728-02 5x 0.1 mg

PIST, CT, Control Peptide (PDZ Protein Interacting Specifically with TC10, CFTR-associated ligand, CAL, dJ94G16.2, Fused in Glioblastoma, FIG, Golgi-associated PDZ and Coiled-coil Motif Containing, Golgi Associated PDZ and Coiled Coil Motif Containing Pro

Sign In for Pricing
View Details
CALCOCO2 Mouse Monoclonal Antibody [Clone ID: OTI7A7]
CF502106 100 µg

CALCOCO2 Mouse Monoclonal Antibody [Clone ID: OTI7A7]

Sign In for Pricing
View Details
Recombinant Shewanella sediminis Threonine--tRNA ligase (thrS), partial
MBS1047123 Inquire

Recombinant Shewanella sediminis Threonine--tRNA ligase (thrS), partial

Sign In for Pricing
View Details
Rat Myosin IA (MYO1A) ELISA kit
201-11-1422 96 Tests

Rat Myosin IA (MYO1A) ELISA kit

Sign In for Pricing
View Details
(1R) -2,2-Difluoro-1-phenylethan-1-amine hydrochloride
TQB43464-01 50 mg

(1R) -2,2-Difluoro-1-phenylethan-1-amine hydrochloride

Sign In for Pricing
View Details