Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB2B Rabbit Polyclonal Antibody (FITC)

RAB2B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ14824

UniProt

Q8WUD1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RAB2B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NTAKEIYRKIQQGLFDVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_116235

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDR, phosphorylated (Y1175) (KDR, FLK1, VEGFR2, Vascular endothelial growth factor receptor 2, Fetal liver kinase 1, Kinase insert domain receptor, Protein-tyrosine kinase receptor flk-1) (MaxLight 550) discontinued
037376-ML550 100 µL

KDR, phosphorylated (Y1175) (KDR, FLK1, VEGFR2, Vascular endothelial growth factor receptor 2, Fetal liver kinase 1, Kinase insert domain receptor, Protein-tyrosine kinase receptor flk-1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Rat SPJ ELISA Kit (Ready to Use)
orb555563-01 48 Tests

Rat SPJ ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Rat SPJ ELISA Kit (Ready to Use)
orb555563-02 96 Tests

Rat SPJ ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
LIPF (NM_004190) Human Recombinant Protein
PROTP07098 20 µg

LIPF (NM_004190) Human Recombinant Protein

Sign In for Pricing
View Details
Human SMG6 qPCR Primer Pair
QH35341S 200 Tests

Human SMG6 qPCR Primer Pair

Sign In for Pricing
View Details
CWF19L1 Rabbit Polyclonal Antibody
orb587348 100 µL

CWF19L1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details