Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFT122 Rabbit Polyclonal Antibody (HRP)

IFT122 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CED, SPG, CED1, FAP80, WDR10, WDR10p, WDR140

UniProt

Q9HBG6

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence EGLDFETAKKAFIRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EGLDFETAKKAFIRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

142 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_443715

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SCYL3 shRNA (UAS) - Lentiviral human SCYL3 shRNA (UAS, GFP) (100)
GTR15095697 1 Vial

Lentiviral human SCYL3 shRNA (UAS) - Lentiviral human SCYL3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
STK3 Recombinant Antibody, Cy5 Conjugated
bsm-61242R-Cy5-01 20 µL

STK3 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
STK3 Recombinant Antibody, Cy5 Conjugated
bsm-61242R-Cy5-02 100 µL

STK3 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
IL-15Ralpha discontinued
537844-01 30ul

IL-15Ralpha discontinued

Sign In for Pricing
View Details
IL-15Ralpha discontinued
537844-02 100 µL

IL-15Ralpha discontinued

Sign In for Pricing
View Details
Luminol
HY-15922-01 500 mg

Luminol

Sign In for Pricing
View Details