Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGK2 Rabbit Polyclonal Antibody (FITC)

PGK2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PGKB, PGKPS, HEL-S-272, dJ417L20.2

UniProt

P07205

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PGK2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_620061

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CCR4 Antibody Picoband® (Carrier-free Conjugate)
A00755-carrier-free 100 µg/Vial

Anti-CCR4 Antibody Picoband® (Carrier-free Conjugate)

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. campestris Protein FdhD homolog (fdhD)
MBS1406266-01 0.02 mg (E-Coli)

Recombinant Xanthomonas campestris pv. campestris Protein FdhD homolog (fdhD)

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. campestris Protein FdhD homolog (fdhD)
MBS1406266-02 0.02 mg (Yeast)

Recombinant Xanthomonas campestris pv. campestris Protein FdhD homolog (fdhD)

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. campestris Protein FdhD homolog (fdhD)
MBS1406266-03 0.1 mg (E-Coli)

Recombinant Xanthomonas campestris pv. campestris Protein FdhD homolog (fdhD)

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. campestris Protein FdhD homolog (fdhD)
MBS1406266-04 0.1 mg (Yeast)

Recombinant Xanthomonas campestris pv. campestris Protein FdhD homolog (fdhD)

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. campestris Protein FdhD homolog (fdhD)
MBS1406266-05 0.02 mg (Baculovirus)

Recombinant Xanthomonas campestris pv. campestris Protein FdhD homolog (fdhD)

Sign In for Pricing
View Details