Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFBP2 Rabbit Polyclonal Antibody (HRP)

IGFBP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IBP2, IGF-BP53

UniProt

P18065

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IGFBP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000588

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nup53 (NUP35) (NM_138285) Human Over-expression Lysate
LS129401 100 µg

Nup53 (NUP35) (NM_138285) Human Over-expression Lysate

Sign In for Pricing
View Details
TSHR Antibody
orb1252183 100 µg

TSHR Antibody

Sign In for Pricing
View Details
Lentiviral human SRSF4 sgRNA gene knockout kit - Lentiviral human SRSF4 sgRNA gene knockout kit (100)
GTR15359059 1 Vial

Lentiviral human SRSF4 sgRNA gene knockout kit - Lentiviral human SRSF4 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Ammonium Bromide 99.5% AR
00189 00500 500 g

Ammonium Bromide 99.5% AR

Sign In for Pricing
View Details
ELAC2 (HPC2, Zinc Phosphodiesterase ELAC Protein 2, ElaC Homolog Protein 2, Heredity Prostate Cancer Protein 2, Ribonuclease Z 2, tRNA 3 Endonuclease 2, tRNase Z 2, FLJ10530, FLJ36693, FLJ42848) (AP) discontinued
126265-AP 100 µL

ELAC2 (HPC2, Zinc Phosphodiesterase ELAC Protein 2, ElaC Homolog Protein 2, Heredity Prostate Cancer Protein 2, Ribonuclease Z 2, tRNA 3 Endonuclease 2, tRNase Z 2, FLJ10530, FLJ36693, FLJ42848) (AP) discontinued

Sign In for Pricing
View Details
CD97 Antibody
orb1268779 400 μl

CD97 Antibody

Sign In for Pricing
View Details