Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Guk1 Rabbit Polyclonal Antibody (HRP)

Guk1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

E9PTV0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RPVVLSGPSGAGKSTLLKKLFQEHGSVFGFSVSHTTRNPRPGEEDGKDYY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001013133

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal APMAP Antibody (OTI4F6) [Janelia Fluor 549]
NBP2-72080JF549 0.1 mL

Mouse Monoclonal APMAP Antibody (OTI4F6) [Janelia Fluor 549]

Sign In for Pricing
View Details
Recombinant Human CNPY2 Protein, GST, E.coli-500ug
QP8489-ec-500ug 500ug

Recombinant Human CNPY2 Protein, GST, E.coli-500ug

Sign In for Pricing
View Details
Anti-biotin (D5A7) Rabbit Monoclonal Antibody (Alexa Fluor® 647 Conjugate)
CST 16555S 250 µL

Anti-biotin (D5A7) Rabbit Monoclonal Antibody (Alexa Fluor® 647 Conjugate)

Sign In for Pricing
View Details
GLDC Polyclonal Antibody
MBS2541260-01 0.06 mL

GLDC Polyclonal Antibody

Sign In for Pricing
View Details
GLDC Polyclonal Antibody
MBS2541260-02 0.12 mL

GLDC Polyclonal Antibody

Sign In for Pricing
View Details
GLDC Polyclonal Antibody
MBS2541260-03 0.2 mL

GLDC Polyclonal Antibody

Sign In for Pricing
View Details