Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Guk1 Rabbit Polyclonal Antibody (HRP)

Guk1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

E9PTV0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RPVVLSGPSGAGKSTLLKKLFQEHGSVFGFSVSHTTRNPRPGEEDGKDYY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001013133

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DENND6A Peptide - middle region (AAP79421)
AAP79421-100UG 100 µg

DENND6A Peptide - middle region (AAP79421)

Sign In for Pricing
View Details
HSP 40 CRISPR Activation Plasmid (h2)
sc-402810-ACT-2 20 µg

HSP 40 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Goat Olfactory Receptor 6C65 (OR6C65) ELISA Kit
MBS7259535-01 48 Well

Goat Olfactory Receptor 6C65 (OR6C65) ELISA Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 6C65 (OR6C65) ELISA Kit
MBS7259535-02 96 Well

Goat Olfactory Receptor 6C65 (OR6C65) ELISA Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 6C65 (OR6C65) ELISA Kit
MBS7259535-03 5x 96 Well

Goat Olfactory Receptor 6C65 (OR6C65) ELISA Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 6C65 (OR6C65) ELISA Kit
MBS7259535-04 10x 96 Well

Goat Olfactory Receptor 6C65 (OR6C65) ELISA Kit

Sign In for Pricing
View Details