Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKIRAS2 Rabbit Polyclonal Antibody (HRP)

NKIRAS2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KBRAS2, kappaB-Ras2

UniProt

Q9NYR9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NKIRAS2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001001349

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Timmdc1 Mouse Gene Knockout Kit (CRISPR)
KN517585 1 Kit

Timmdc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SAP155 (SF3B1) Human Gene Knockout Kit (CRISPR)
KN219649LP 1 Kit

SAP155 (SF3B1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-(4-Nitrophenyl)propionic Acid
TRC-N504495-5G 5 g

2-(4-Nitrophenyl)propionic Acid

Sign In for Pricing
View Details
Gfpt1 Mouse Gene Knockout Kit (CRISPR)
KN306419RB 1 Kit

Gfpt1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CF®750 Rabbit Anti-DNP, 2 mg/mL
#20875-250uL 1x 250 µL

CF®750 Rabbit Anti-DNP, 2 mg/mL

Sign In for Pricing
View Details
CRBN Recombinant Rabbit Monoclonal Antibody [PSH0-70]
HA721458 100 µL

CRBN Recombinant Rabbit Monoclonal Antibody [PSH0-70]

Sign In for Pricing
View Details