Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KPNA3 Rabbit Polyclonal Antibody (HRP)

KPNA3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SRP1, SRP4, IPOA4, hSRP1, SRP1gamma

UniProt

O00505

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KPNA3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNV

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002258

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAPN12 Antibody
A48221-100UL 100 µL

CAPN12 Antibody

Sign In for Pricing
View Details
SM22 Alpha Polyclonal Antibody Cy5 Conjugated
orb1542691 100 µL

SM22 Alpha Polyclonal Antibody Cy5 Conjugated

Sign In for Pricing
View Details
SUPT4H1 Antibody - middle region : HRP (ARP38258_P050-HRP)
ARP38258_P050-HRP 100 µL

SUPT4H1 Antibody - middle region : HRP (ARP38258_P050-HRP)

Sign In for Pricing
View Details
SCN4B Rabbit Polyclonal Antibody (RBITC)
orb1076067 100 µL

SCN4B Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Human Microspherule Protein 1 (MCRS1) ELISA Kit
MBS9312667-01 48 Well

Human Microspherule Protein 1 (MCRS1) ELISA Kit

Sign In for Pricing
View Details
Human Microspherule Protein 1 (MCRS1) ELISA Kit
MBS9312667-02 96 Well

Human Microspherule Protein 1 (MCRS1) ELISA Kit

Sign In for Pricing
View Details