Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP5 Rabbit Polyclonal Antibody (HRP)

FKBP5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P54, AIG6, FKBP51, FKBP54, PPIase, Ptg-10

UniProt

Q13451

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human FKBP5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESW

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004108

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromo-4-aminobenzoic Acid
TRC-B679450-250MG 250 mg

2-Bromo-4-aminobenzoic Acid

Sign In for Pricing
View Details
Human UNC5C activation kit by CRISPRa
GA105717 1 Kit

Human UNC5C activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR562094 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
MAN1 (LEMD3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C8]
TA500815BM 100 µL

MAN1 (LEMD3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C8]

Sign In for Pricing
View Details
LIM Kinase 1 (LIMK1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8C8]
TA502978AM 100 µL

LIM Kinase 1 (LIMK1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8C8]

Sign In for Pricing
View Details
TIM 3 (HAVCR2) Mouse Monoclonal Antibody [Clone ID: OTI2E5]
CF812559 100 µg

TIM 3 (HAVCR2) Mouse Monoclonal Antibody [Clone ID: OTI2E5]

Sign In for Pricing
View Details