Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP5 Rabbit Polyclonal Antibody (HRP)

FKBP5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P54, AIG6, FKBP51, FKBP54, PPIase, Ptg-10

UniProt

Q13451

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human FKBP5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESW

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004108

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FK506 Binding Protein 5 (FKBP5) ELISA Kit
RDR-FKBP5-Hu-01 96 Tests

Human FK506 Binding Protein 5 (FKBP5) ELISA Kit

Sign In for Pricing
View Details
Human FK506 Binding Protein 5 (FKBP5) ELISA Kit
RDR-FKBP5-Hu-02 48 Tests

Human FK506 Binding Protein 5 (FKBP5) ELISA Kit

Sign In for Pricing
View Details
PPP3CB (NM_001142353) Human Over-expression Lysate
LC428053 20 µg

PPP3CB (NM_001142353) Human Over-expression Lysate

Sign In for Pricing
View Details
Slamf8 Mouse Gene Knockout Kit (CRISPR)
KN515849 1 Kit

Slamf8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TLR7 Human Gene Knockout Kit (CRISPR)
KN207515LP 1 Kit

TLR7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat S100 Calcium Binding Protein A11 (S100A11) ELISA Kit
RDR-S100A11-Ra-01 96 Tests

Rat S100 Calcium Binding Protein A11 (S100A11) ELISA Kit

Sign In for Pricing
View Details