Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDI1 Rabbit Polyclonal Antibody (Biotin)

IDI1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IPP1, IPPI1

UniProt

Q13907

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IDI1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004499

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leo1 (RNA Polymerase-Associated Protein LEO1, Leo1, Gm185)
302524 200 µL

Leo1 (RNA Polymerase-Associated Protein LEO1, Leo1, Gm185)

Sign In for Pricing
View Details
TAF8 (Transcription Initiation Factor TFIID Subunit 8, TBP-associated Factor 8, Protein Taube Nuss, TBN, TBP-associated Factor 43kD, Transcription Initiation Factor TFIID 43kD Subunit, TAFII-43, TAFII43, hTAFII43) (AP)
MBS6395961-01 0.1 mL

TAF8 (Transcription Initiation Factor TFIID Subunit 8, TBP-associated Factor 8, Protein Taube Nuss, TBN, TBP-associated Factor 43kD, Transcription Initiation Factor TFIID 43kD Subunit, TAFII-43, TAFII43, hTAFII43) (AP)

Sign In for Pricing
View Details
TAF8 (Transcription Initiation Factor TFIID Subunit 8, TBP-associated Factor 8, Protein Taube Nuss, TBN, TBP-associated Factor 43kD, Transcription Initiation Factor TFIID 43kD Subunit, TAFII-43, TAFII43, hTAFII43) (AP)
MBS6395961-02 5x 0.1 mL

TAF8 (Transcription Initiation Factor TFIID Subunit 8, TBP-associated Factor 8, Protein Taube Nuss, TBN, TBP-associated Factor 43kD, Transcription Initiation Factor TFIID 43kD Subunit, TAFII-43, TAFII43, hTAFII43) (AP)

Sign In for Pricing
View Details
Anti-PGRMC2 Antibody Picoband® FITC Conjugated
A06531-1-FITC 100 µg/Vial

Anti-PGRMC2 Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Cell division protein SepF (sepF)
MBS1324461-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Cell division protein SepF (sepF)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Cell division protein SepF (sepF)
MBS1324461-02 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Cell division protein SepF (sepF)

Sign In for Pricing
View Details