Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gdf10 Rabbit Polyclonal Antibody (HRP)

Gdf10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Bmp3, Bmp3b

UniProt

P59672

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RYDPFPAGDFEPGAAPNSSADPRVRRAAQVSKPLQDNELPGLDERPAPAL

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_852078

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-18R alpha CD218a Antibody FITC Conjugated
MBS9461112-01 0.1 mL

IL-18R alpha CD218a Antibody FITC Conjugated

Sign In for Pricing
View Details
IL-18R alpha CD218a Antibody FITC Conjugated
MBS9461112-02 5x 0.1 mL

IL-18R alpha CD218a Antibody FITC Conjugated

Sign In for Pricing
View Details
NKX3-1 (Homeobox Protein Nkx-3.1, Homeobox Protein NK-3 Homolog A, NKX3.1, NKX3A) (MaxLight 750) discontinued
130400-ML750 100 µL

NKX3-1 (Homeobox Protein Nkx-3.1, Homeobox Protein NK-3 Homolog A, NKX3.1, NKX3A) (MaxLight 750) discontinued

Sign In for Pricing
View Details
2-Trifluoromethanesulfinylbenzoic acid
EDA67657-01 50 mg

2-Trifluoromethanesulfinylbenzoic acid

Sign In for Pricing
View Details
2-Trifluoromethanesulfinylbenzoic acid
EDA67657-02 0.5 g

2-Trifluoromethanesulfinylbenzoic acid

Sign In for Pricing
View Details
HES4 Rabbit Polyclonal Antibody (Cy5)
orb1011372 100 µL

HES4 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details