Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LASP1 Rabbit Polyclonal Antibody (Biotin)

LASP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MLN50, Lasp-1

UniProt

Q14847

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LASP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQ

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006139

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Lymphocyte Function Associated Antigen 3 (LFA-3) ELISA Kit
MBS261474-01 48 Well

Mouse Lymphocyte Function Associated Antigen 3 (LFA-3) ELISA Kit

Sign In for Pricing
View Details
Mouse Lymphocyte Function Associated Antigen 3 (LFA-3) ELISA Kit
MBS261474-02 96 Well

Mouse Lymphocyte Function Associated Antigen 3 (LFA-3) ELISA Kit

Sign In for Pricing
View Details
Mouse Lymphocyte Function Associated Antigen 3 (LFA-3) ELISA Kit
MBS261474-03 5x 96 Well

Mouse Lymphocyte Function Associated Antigen 3 (LFA-3) ELISA Kit

Sign In for Pricing
View Details
Mouse Lymphocyte Function Associated Antigen 3 (LFA-3) ELISA Kit
MBS261474-04 10x 96 Well

Mouse Lymphocyte Function Associated Antigen 3 (LFA-3) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Wfdc6b shRNA (UAS) - Lentiviral mouse Wfdc6b shRNA (UAS, GFP) (100)
GTR15209253 1 Vial

Lentiviral mouse Wfdc6b shRNA (UAS) - Lentiviral mouse Wfdc6b shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
RBM46 Polyclonal Antibody
MBS2565704-01 0.06 mL

RBM46 Polyclonal Antibody

Sign In for Pricing
View Details