Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNA12 Rabbit Polyclonal Antibody (Biotin)

GNA12 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RMP, gep, NNX3

UniProt

Q03113

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GNA12

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVRFVFH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_031379

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Influenza A (Biotin)
I7650-04C-Biotin 100 µL

Influenza A (Biotin)

Sign In for Pricing
View Details
Ephb1 (Ephrin Type-B Receptor 1, Ephb1) (Biotin)
MBS6455823-01 0.2 mL

Ephb1 (Ephrin Type-B Receptor 1, Ephb1) (Biotin)

Sign In for Pricing
View Details
Ephb1 (Ephrin Type-B Receptor 1, Ephb1) (Biotin)
MBS6455823-02 5x 0.2 mL

Ephb1 (Ephrin Type-B Receptor 1, Ephb1) (Biotin)

Sign In for Pricing
View Details
Mouse Probable G-protein coupled receptor 113, GPR113 ELISA Kit
MBS9332770-01 48 Well

Mouse Probable G-protein coupled receptor 113, GPR113 ELISA Kit

Sign In for Pricing
View Details
Mouse Probable G-protein coupled receptor 113, GPR113 ELISA Kit
MBS9332770-02 96 Well

Mouse Probable G-protein coupled receptor 113, GPR113 ELISA Kit

Sign In for Pricing
View Details
Mouse Probable G-protein coupled receptor 113, GPR113 ELISA Kit
MBS9332770-03 5x 96 Well

Mouse Probable G-protein coupled receptor 113, GPR113 ELISA Kit

Sign In for Pricing
View Details