Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFIT5 Rabbit Polyclonal Antibody (Biotin)

IFIT5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P58, RI58, ISG58

UniProt

Q13325

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IFIT5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_036552

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF114 Rabbit pAb
E45R30164N-100 100 µL

RNF114 Rabbit pAb

Sign In for Pricing
View Details
Anti-ENPP7 Antibody (8R662)
TMAY-01285 100 µL

Anti-ENPP7 Antibody (8R662)

Sign In for Pricing
View Details
Mouse Monoclonal Fibronectin Antibody (960632) [Alexa Fluor 350]
MAB8258AF350 0.1 mL

Mouse Monoclonal Fibronectin Antibody (960632) [Alexa Fluor 350]

Sign In for Pricing
View Details
Nags sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3578505 3x 1.0 µg

Nags sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
BST2 (Bone Marrow Stromal Cell antigen 2, CD317) (MaxLight 750)
MBS6450594-01 0.1 mL

BST2 (Bone Marrow Stromal Cell antigen 2, CD317) (MaxLight 750)

Sign In for Pricing
View Details
BST2 (Bone Marrow Stromal Cell antigen 2, CD317) (MaxLight 750)
MBS6450594-02 5x 0.1 mL

BST2 (Bone Marrow Stromal Cell antigen 2, CD317) (MaxLight 750)

Sign In for Pricing
View Details