Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLM Rabbit Polyclonal Antibody (Biotin)

POLM Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Tdt-N, Pol Mu

UniProt

Q9NP87

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human POLM

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRN

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_037416

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prkcg (NM_011102) Mouse Tagged ORF Clone Lentiviral Particle
MR222290L4V 200 µL

Prkcg (NM_011102) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit IgG (H&L) Antibody - AP Conjugated
OARA04608-1MG 1 mg

Rabbit IgG (H&L) Antibody - AP Conjugated

Sign In for Pricing
View Details
P115 (m) -PR
sc-41283-PR 10 µM - 20 µL

P115 (m) -PR

Sign In for Pricing
View Details
Mouse ATP-binding cassette sub-family A member 2 (ABCA2) ELISA Kit
MBS7243686-01 48 Well

Mouse ATP-binding cassette sub-family A member 2 (ABCA2) ELISA Kit

Sign In for Pricing
View Details
Mouse ATP-binding cassette sub-family A member 2 (ABCA2) ELISA Kit
MBS7243686-02 96 Well

Mouse ATP-binding cassette sub-family A member 2 (ABCA2) ELISA Kit

Sign In for Pricing
View Details
Mouse ATP-binding cassette sub-family A member 2 (ABCA2) ELISA Kit
MBS7243686-03 5x 96 Well

Mouse ATP-binding cassette sub-family A member 2 (ABCA2) ELISA Kit

Sign In for Pricing
View Details