Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITPK1 Rabbit Polyclonal Antibody (HRP)

ITPK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ITRPK1

UniProt

Q13572

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ITPK1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055031

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFKBIL2, NT (TONSL, IKBR, NFKBIL2, Tonsoku-like protein, Inhibitor of kappa B-related protein, NF-kappa-B inhibitor-like protein 2, Nuclear factor of kappa light polypeptide gene enhancer in B Cells inhibitor-like 2) (MaxLight 650) discontinued
038946-ML650 100 µL

NFKBIL2, NT (TONSL, IKBR, NFKBIL2, Tonsoku-like protein, Inhibitor of kappa B-related protein, NF-kappa-B inhibitor-like protein 2, Nuclear factor of kappa light polypeptide gene enhancer in B Cells inhibitor-like 2) (MaxLight 650) discontinued

Sign In for Pricing
View Details
C19orf40 Polyclonal Antibody
MBS9434417-01 0.05 mL

C19orf40 Polyclonal Antibody

Sign In for Pricing
View Details
C19orf40 Polyclonal Antibody
MBS9434417-02 0.1 mL

C19orf40 Polyclonal Antibody

Sign In for Pricing
View Details
C19orf40 Polyclonal Antibody
MBS9434417-03 5x 0.1 mL

C19orf40 Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome P450 17A1 Rabbit Polyclonal Antibody (Biotin)
orb446551 100 µL

Cytochrome P450 17A1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Blood Tube Package 1
EQ10-BTP 1 Each

Blood Tube Package 1

Sign In for Pricing
View Details