Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGD1564209 Rabbit Polyclonal Antibody (HRP)

RGD1564209 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1564209

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LFPVDVMRKAAQLGFGGIYVRTDVGGSGLSRLDTSVIFEALATGCTSTTA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_001053896

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor B Recombinant Antibody, FITC Conjugated
bsm-62391R-FITC 100 µL

Factor B Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
PSMD7 Rabbit Polyclonal Antibody (Fluoro488)
orb3097350 100 µg

PSMD7 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Recombinant SALL4 Monoclonal Antibody
AN301651L-01 50 µL

Recombinant SALL4 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SALL4 Monoclonal Antibody
AN301651L-02 100 µL

Recombinant SALL4 Monoclonal Antibody

Sign In for Pricing
View Details
Alpha Fetoprotein from Pooled Cord serum
B2014155 0.5 mg

Alpha Fetoprotein from Pooled Cord serum

Sign In for Pricing
View Details
Human Cancer Tissue Preparation Buffer 6: Colorectal Tumor Cells
9-80029 1x 100 mL

Human Cancer Tissue Preparation Buffer 6: Colorectal Tumor Cells

Sign In for Pricing
View Details