Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB21 Rabbit Polyclonal Antibody (Biotin)

RAB21 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RAB21, KIAA0118

UniProt

Q9UL25

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB21

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQP

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_055814

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human C1orf50 sgRNA gene knockout kit - Lentiviral human C1orf50 sgRNA gene knockout kit (100)
GTR15361744 1 Vial

Lentiviral human C1orf50 sgRNA gene knockout kit - Lentiviral human C1orf50 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
EB3 CRISPR Activation Plasmid (m2)
sc-430339-ACT-2 20 µg

EB3 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
SCAF8 Protein Vector (Mouse) (pPB-C-His)
PV226818 500 ng

SCAF8 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 2 subtype B Protein Tat (tat)
MBS1311779-01 0.02 mg (E-Coli)

Recombinant Human immunodeficiency virus type 2 subtype B Protein Tat (tat)

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 2 subtype B Protein Tat (tat)
MBS1311779-02 0.1 mg (E-Coli)

Recombinant Human immunodeficiency virus type 2 subtype B Protein Tat (tat)

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 2 subtype B Protein Tat (tat)
MBS1311779-03 0.02 mg (Yeast)

Recombinant Human immunodeficiency virus type 2 subtype B Protein Tat (tat)

Sign In for Pricing
View Details