Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C22orf9 Rabbit Polyclonal Antibody (HRP)

C22orf9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LSC3, C22orf9

UniProt

Q6ICG6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C22orf9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ERVTSFSTPPTPERNNRPAFFSPSLKRKVPRNRIAEMKKSHSANDSEEFF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056079

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

T.S Fibers
4040900/12C 1 Each

T.S Fibers

Sign In for Pricing
View Details
ZCCHC12 (Zinc Finger CCHC Domain-containing Protein 12, Smad-interacting Zinc Finger Protein 1, SIZN1, SIZN, PNMA7A)
135526 50 µg

ZCCHC12 (Zinc Finger CCHC Domain-containing Protein 12, Smad-interacting Zinc Finger Protein 1, SIZN1, SIZN, PNMA7A)

Sign In for Pricing
View Details
Entamoeba Histolytica & Dispar
397233 1 mg

Entamoeba Histolytica & Dispar

Sign In for Pricing
View Details
PI 3 Kinase p85 alpha (PIK3R1) (NM_001242466) Human Tagged ORF Clone
RG233876 10 µg

PI 3 Kinase p85 alpha (PIK3R1) (NM_001242466) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rat Monoclonal Semaphorin 4F Antibody (780225) [Alexa Fluor 532]
FAB7200X 0.1 mL

Rat Monoclonal Semaphorin 4F Antibody (780225) [Alexa Fluor 532]

Sign In for Pricing
View Details
Western Antibody Dilution Buffer (Block Quickly)
MBS2576096-01 100 mL

Western Antibody Dilution Buffer (Block Quickly)

Sign In for Pricing
View Details