Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C22orf9 Rabbit Polyclonal Antibody (HRP)

C22orf9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LSC3, C22orf9

UniProt

Q6ICG6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C22orf9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ERVTSFSTPPTPERNNRPAFFSPSLKRKVPRNRIAEMKKSHSANDSEEFF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056079

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG4A Rabbit Polyclonal Antibody (Biotin)
orb2121745 100 µL

ATG4A Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rad50, CT (Rad50, DNA repair protein RAD50) (MaxLight 750)
MBS6340018-01 0.1 mL

Rad50, CT (Rad50, DNA repair protein RAD50) (MaxLight 750)

Sign In for Pricing
View Details
Rad50, CT (Rad50, DNA repair protein RAD50) (MaxLight 750)
MBS6340018-02 5x 0.1 mL

Rad50, CT (Rad50, DNA repair protein RAD50) (MaxLight 750)

Sign In for Pricing
View Details
VANGL2 (Vang-like 2 (van gogh, Drosophila) KIAA1215, LPP1, LTAP, MGC119403, MGC119404, STBM, Homolog of Drosophila Strabismus, Loop-tail-associated Protein, Vang (Van Gogh, Drosophila) -like 2, Vang (Van Gogh, Drosophila) -like 2, Vang, Van Gogh-like 2)
V0499-17B 100 µg

VANGL2 (Vang-like 2 (van gogh, Drosophila) KIAA1215, LPP1, LTAP, MGC119403, MGC119404, STBM, Homolog of Drosophila Strabismus, Loop-tail-associated Protein, Vang (Van Gogh, Drosophila) -like 2, Vang (Van Gogh, Drosophila) -like 2, Vang, Van Gogh-like 2)

Sign In for Pricing
View Details
HPV16 L2 (2JGmab#4)
sc-65708 200 µg/mL

HPV16 L2 (2JGmab#4)

Sign In for Pricing
View Details
RPS27AP16 sgRNA CRISPR Lentivector set (Human)
K2055801 3x 1.0 µg

RPS27AP16 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details