Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angel1 Rabbit Polyclonal Antibody (FITC)

Angel1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MKIAA0759, 1110030H02Rik

UniProt

Q8VCU0

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SPLYNFIRDGELQYNGMPAWKVSGQEDFSHQLYQRKLQAPLWPSSLGITD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_653107

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Human Pituitary adenylate cyclase - activating polypeptide type I receptor (ADCYAP1R1) ELISA
KBH20074 96 Well

GENLISA™ Human Pituitary adenylate cyclase - activating polypeptide type I receptor (ADCYAP1R1) ELISA

Sign In for Pricing
View Details
Withanoside VII
CS-O-62491 1 Each

Withanoside VII

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC Adenylyl-sulfate kinase (cysC)
MBS1213113-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O1:K1 / APEC Adenylyl-sulfate kinase (cysC)

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC Adenylyl-sulfate kinase (cysC)
MBS1213113-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O1:K1 / APEC Adenylyl-sulfate kinase (cysC)

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC Adenylyl-sulfate kinase (cysC)
MBS1213113-03 0.02 mg (Yeast)

Recombinant Escherichia coli O1:K1 / APEC Adenylyl-sulfate kinase (cysC)

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC Adenylyl-sulfate kinase (cysC)
MBS1213113-04 0.1 mg (Yeast)

Recombinant Escherichia coli O1:K1 / APEC Adenylyl-sulfate kinase (cysC)

Sign In for Pricing
View Details