Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRPC4AP Rabbit Polyclonal Antibody (HRP)

TRPC4AP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TRUSS, TRRP4AP, PPP1R158, C20orf188

UniProt

Q8TEL6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRPC4AP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056453

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Homocysteic acid, Hcy ELISA Kit
CK-bio-16374-01 48 Tests

Mouse Homocysteic acid, Hcy ELISA Kit

Sign In for Pricing
View Details
Mouse Homocysteic acid, Hcy ELISA Kit
CK-bio-16374-02 96 Tests

Mouse Homocysteic acid, Hcy ELISA Kit

Sign In for Pricing
View Details
Mouse Homocysteic acid, Hcy ELISA Kit
CK-bio-16374-03 5x 96 Tests

Mouse Homocysteic acid, Hcy ELISA Kit

Sign In for Pricing
View Details
Mouse Homocysteic acid, Hcy ELISA Kit
CK-bio-16374-04 10x 96 Tests

Mouse Homocysteic acid, Hcy ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Sowahb shRNA (UAS) - Lentiviral mouse Sowahb shRNA (UAS) plasmid
GTR15265615 1 Vial

Lentiviral mouse Sowahb shRNA (UAS) - Lentiviral mouse Sowahb shRNA (UAS) plasmid

Sign In for Pricing
View Details
EBI3 siRNA (Human)
MBS8223444-01 15 nmol

EBI3 siRNA (Human)

Sign In for Pricing
View Details