Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTK1 Rabbit Polyclonal Antibody (HRP)

GSTK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GST, GST13, hGSTK1, GSTK1-1, GST13-13, GST 13-13

UniProt

Q9Y2Q3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GSTK1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057001

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bulk Anti-Human iNKT Cell (6B11) Antibody
ICH1032-5mg 5 mg

Bulk Anti-Human iNKT Cell (6B11) Antibody

Sign In for Pricing
View Details
Rbmx2 Mouse Gene Knockout Kit (CRISPR)
KN514587 1 Kit

Rbmx2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), CF568 conjugate, 0.1mg/mL
BNC681758-100 1x 100 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Rat IgM, κ Isotype Control[RTK2118]
E-AB-F09772T-01 20 Tests

Elab Fluor® Violet 610 Rat IgM, κ Isotype Control[RTK2118]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Rat IgM, κ Isotype Control[RTK2118]
E-AB-F09772T-02 100 Tests

Elab Fluor® Violet 610 Rat IgM, κ Isotype Control[RTK2118]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Rat IgM, κ Isotype Control[RTK2118]
E-AB-F09772T-03 2x 100 Tests

Elab Fluor® Violet 610 Rat IgM, κ Isotype Control[RTK2118]

Sign In for Pricing
View Details