Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mapk8ip2 Rabbit Polyclonal Antibody (FITC)

Mapk8ip2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

IB-2, JIP-2

UniProt

G3V9M2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Mapk8ip2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SEPEPEPEPEPLHEPPRRPAFLPVGQDDTNSEYESGSESEPDLSEDADSP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_001055248

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Nuclear receptor ROR-gamma, RORC ELISA Kit
MBS911044-01 24 Well (LIMIT 1)

Human Nuclear receptor ROR-gamma, RORC ELISA Kit

Sign In for Pricing
View Details
Human Nuclear receptor ROR-gamma, RORC ELISA Kit
MBS911044-02 48 Well

Human Nuclear receptor ROR-gamma, RORC ELISA Kit

Sign In for Pricing
View Details
Human Nuclear receptor ROR-gamma, RORC ELISA Kit
MBS911044-03 96 Well

Human Nuclear receptor ROR-gamma, RORC ELISA Kit

Sign In for Pricing
View Details
Human Nuclear receptor ROR-gamma, RORC ELISA Kit
MBS911044-04 5x 96 Well

Human Nuclear receptor ROR-gamma, RORC ELISA Kit

Sign In for Pricing
View Details
Human Nuclear receptor ROR-gamma, RORC ELISA Kit
MBS911044-05 10x 96 Well

Human Nuclear receptor ROR-gamma, RORC ELISA Kit

Sign In for Pricing
View Details
Dichloro Bisphenol S
TRC-D432324-25MG 25 mg

Dichloro Bisphenol S

Sign In for Pricing
View Details