Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELP4 Rabbit Polyclonal Antibody (FITC)

ELP4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AN, AN2, hELP4, PAXNEB, PAX6NEB, C11orf19, dJ68P15A.1

UniProt

Q96EB1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ELP4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For ATP synthase subunit f, mitochondrial
E12583m 96 Tests

ELISA Kit For ATP synthase subunit f, mitochondrial

Sign In for Pricing
View Details
Pex13 sgRNA CRISPR Lentivector set (Mouse)
K4637501 3x 1.0 µg

Pex13 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
ERG polyclonal antibody
orb646422-01 50 μL

ERG polyclonal antibody

Sign In for Pricing
View Details
ERG polyclonal antibody
orb646422-02 100 µL

ERG polyclonal antibody

Sign In for Pricing
View Details
ERG polyclonal antibody
orb646422-03 200 µL

ERG polyclonal antibody

Sign In for Pricing
View Details
ADORA2B Peptide
DF8635-BP 1 mg

ADORA2B Peptide

Sign In for Pricing
View Details