Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELP4 Rabbit Polyclonal Antibody (FITC)

ELP4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AN, AN2, hELP4, PAXNEB, PAX6NEB, C11orf19, dJ68P15A.1

UniProt

Q96EB1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ELP4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal CD40 Ligand/TNFSF5 Antibody (208109) [DyLight 594]
FAB1163M 0.5 mL

Rat Monoclonal CD40 Ligand/TNFSF5 Antibody (208109) [DyLight 594]

Sign In for Pricing
View Details
MRPS34 Protein Vector (Human) (pPB-N-His)
PV026786 500 ng

MRPS34 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
C10orf7 (CDC123) Mouse Monoclonal Antibody [Clone ID: LBI2D4]
AMM13376VCF 100 µg

C10orf7 (CDC123) Mouse Monoclonal Antibody [Clone ID: LBI2D4]

Sign In for Pricing
View Details
GRB 14 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-13641R-PerCP-Cy5.5 100 µL

GRB 14 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
IGF1R Rabbit Polyclonal Antibody (BF350)
orb1610509 100 µL

IGF1R Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Chicken ATP-binding cassette sub-family C member 8 (ABCC8) ELISA Kit
MBS7249950-01 48 Well

Chicken ATP-binding cassette sub-family C member 8 (ABCC8) ELISA Kit

Sign In for Pricing
View Details