Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FANCE Rabbit Polyclonal Antibody (HRP)

FANCE Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FAE, FACE

UniProt

Q9HB96

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FANCE

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SPQAPDPEEEENRDSQQPGKRRKDSEEEAASPEGKRVPKRLRCWEEEEDH

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_068741

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Slc16a4 shRNA (UAS) - Lentiviral mouse Slc16a4 shRNA (UAS, RFP) (25)
GTR15193379 1 Vial

Lentiviral mouse Slc16a4 shRNA (UAS) - Lentiviral mouse Slc16a4 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
TCEAL3 (Transcription Elongation Factor A Protein-like 3, Transcription Elongation Factor S-II Protein-like 3)
368350 100 µg

TCEAL3 (Transcription Elongation Factor A Protein-like 3, Transcription Elongation Factor S-II Protein-like 3)

Sign In for Pricing
View Details
C17orf37 (Chromosome 17 Open Reading Frame 37, C35, MGC14832, ORB3, RDX12, XTP4) (FITC)
MBS6178691-01 0.1 mL

C17orf37 (Chromosome 17 Open Reading Frame 37, C35, MGC14832, ORB3, RDX12, XTP4) (FITC)

Sign In for Pricing
View Details
C17orf37 (Chromosome 17 Open Reading Frame 37, C35, MGC14832, ORB3, RDX12, XTP4) (FITC)
MBS6178691-02 5x 0.1 mL

C17orf37 (Chromosome 17 Open Reading Frame 37, C35, MGC14832, ORB3, RDX12, XTP4) (FITC)

Sign In for Pricing
View Details
BRF1 Antibody
orb1424360 100 µL

BRF1 Antibody

Sign In for Pricing
View Details
PriboFast® Peanut ELISA Kit
EKT-PN20 96 Tests

PriboFast® Peanut ELISA Kit

Sign In for Pricing
View Details