Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABRAXAS2 Rabbit Polyclonal Antibody (HRP)

ABRAXAS2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ABRO1, FAM175B, KIAA0157

UniProt

Q15018

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KIAA0157

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GDSGEDSDDSDYENLIDPTEPSNSEYSHSKDSRPMAHPDEDPRNTQTSQI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115558

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RTEL1 Antibody - C-terminal region
ARP74195_P050-25UL 25 µL

RTEL1 Antibody - C-terminal region

Sign In for Pricing
View Details
Phospho-Smad2 (Ser465 + Ser467) Rabbit Polyclonal Antibody (APC-Cy7)
orb1581127 100 µL

Phospho-Smad2 (Ser465 + Ser467) Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Kv9.3 K+ channel Mouse Monoclonal Antibody
orb2957691-01 50 µg

Kv9.3 K+ channel Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Kv9.3 K+ channel Mouse Monoclonal Antibody
orb2957691-02 100 µg

Kv9.3 K+ channel Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Kv9.3 K+ channel Mouse Monoclonal Antibody
orb2957691-03 1 mg

Kv9.3 K+ channel Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Anti-GPRC5D Antibody Picoband® HRP Conjugated
A13912-2-HRP 100 µg/Vial

Anti-GPRC5D Antibody Picoband® HRP Conjugated

Sign In for Pricing
View Details