Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM124A Rabbit Polyclonal Antibody (FITC)

FAM124A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ30707

UniProt

Q86V42

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FAM124A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VSRVTTEASWASLPFFTKRSSSSSATARAAPPAPSTSTLTDSSPQLPCDT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_659456

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFBR2 (27-85) Sheep Polyclonal Antibody
AP05024PU-N 50 µg

TGFBR2 (27-85) Sheep Polyclonal Antibody

Sign In for Pricing
View Details
ATM, NT (Serine-protein Kinase ATM, Ataxia Telangiectasia Mutated, A-T Mutated) (MaxLight 650) discontinued
A4000-19B-ML650 100 µL

ATM, NT (Serine-protein Kinase ATM, Ataxia Telangiectasia Mutated, A-T Mutated) (MaxLight 650) discontinued

Sign In for Pricing
View Details
PLV3-CMV-PCF11 (human) -3xFLAG-CopGFP-Puro
BZ62270 1 Vial

PLV3-CMV-PCF11 (human) -3xFLAG-CopGFP-Puro

Sign In for Pricing
View Details
Serum-Free Cell Freezing Medium (HEK293 cells)
K1148-50 50 mL

Serum-Free Cell Freezing Medium (HEK293 cells)

Sign In for Pricing
View Details
CD23 (FCER2, Low Affinity Immunoglobulin epsilon Fc Receptor, BLAST-2, C-type Lectin Domain Family 4 Member J, Fc-epsilon-RII, Immunoglobulin E-binding Factor, Lymphocyte IgE Receptor, CD23A, CLEC4J, FCE2, IGEBF) (MaxLight 650)
MBS6264908-01 0.1 mL

CD23 (FCER2, Low Affinity Immunoglobulin epsilon Fc Receptor, BLAST-2, C-type Lectin Domain Family 4 Member J, Fc-epsilon-RII, Immunoglobulin E-binding Factor, Lymphocyte IgE Receptor, CD23A, CLEC4J, FCE2, IGEBF) (MaxLight 650)

Sign In for Pricing
View Details
CD23 (FCER2, Low Affinity Immunoglobulin epsilon Fc Receptor, BLAST-2, C-type Lectin Domain Family 4 Member J, Fc-epsilon-RII, Immunoglobulin E-binding Factor, Lymphocyte IgE Receptor, CD23A, CLEC4J, FCE2, IGEBF) (MaxLight 650)
MBS6264908-02 5x 0.1 mL

CD23 (FCER2, Low Affinity Immunoglobulin epsilon Fc Receptor, BLAST-2, C-type Lectin Domain Family 4 Member J, Fc-epsilon-RII, Immunoglobulin E-binding Factor, Lymphocyte IgE Receptor, CD23A, CLEC4J, FCE2, IGEBF) (MaxLight 650)

Sign In for Pricing
View Details