Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IQCE Rabbit Polyclonal Antibody (Biotin)

IQCE Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PAPA7, 1700028P05Rik

UniProt

Q6IPM2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IQCE

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_689771

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEB2 Knockout HEK293T Polyclonal Cells
ARG4378 1 Million

MAGEB2 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
CDKN3 Human Over-expression Lysate
orb1361201 20 µg

CDKN3 Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mouse CD4, Tag Free
P2012-.01 10 µg

Recombinant Mouse CD4, Tag Free

Sign In for Pricing
View Details
PPFIBP1 (Protein Tyrosine Phosphatase Receptor type F Polypeptide-interacting Protein-binding Protein 1, L2, SGT2, hSGT2, hSgt2p) (Biotin)
MBS6432493-01 0.1 mL

PPFIBP1 (Protein Tyrosine Phosphatase Receptor type F Polypeptide-interacting Protein-binding Protein 1, L2, SGT2, hSGT2, hSgt2p) (Biotin)

Sign In for Pricing
View Details
PPFIBP1 (Protein Tyrosine Phosphatase Receptor type F Polypeptide-interacting Protein-binding Protein 1, L2, SGT2, hSGT2, hSgt2p) (Biotin)
MBS6432493-02 5x 0.1 mL

PPFIBP1 (Protein Tyrosine Phosphatase Receptor type F Polypeptide-interacting Protein-binding Protein 1, L2, SGT2, hSGT2, hSgt2p) (Biotin)

Sign In for Pricing
View Details
Anti-Osteopontin/SPP1 Antibody Picoband®, FITC Conjugate
PA1431-FITC 100 µg/Vial

Anti-Osteopontin/SPP1 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details