Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HEPACAM Rabbit Polyclonal Antibody (FITC)

HEPACAM Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RGD1306811

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1306811

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ALRLSPFVYLLLIQPVPLEGVNITSPVRLIHGTVGKSALLSVQYSSTSSD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_002727080

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFN2 (Mitofusin 2, HSG, MARF, CMT2A, CPRP1, CMT2A2) (MaxLight 650)
MBS6426680-01 0.1 mL

MFN2 (Mitofusin 2, HSG, MARF, CMT2A, CPRP1, CMT2A2) (MaxLight 650)

Sign In for Pricing
View Details
MFN2 (Mitofusin 2, HSG, MARF, CMT2A, CPRP1, CMT2A2) (MaxLight 650)
MBS6426680-02 5x 0.1 mL

MFN2 (Mitofusin 2, HSG, MARF, CMT2A, CPRP1, CMT2A2) (MaxLight 650)

Sign In for Pricing
View Details
Anti-NK-3R Rabbit pAb
GB11761-50 50 μL

Anti-NK-3R Rabbit pAb

Sign In for Pricing
View Details
Glycoprotein VI (Platelet (GP6) Human ELISA Kit
D7776 96 Tests

Glycoprotein VI (Platelet (GP6) Human ELISA Kit

Sign In for Pricing
View Details
PDI Antibody
MBS9521415-01 0.04 mL

PDI Antibody

Sign In for Pricing
View Details
PDI Antibody
MBS9521415-02 0.1 mL

PDI Antibody

Sign In for Pricing
View Details