Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTRA4 Rabbit Polyclonal Antibody (HRP)

HTRA4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ90724

UniProt

P83105

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HTRA4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_710159

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNLIPRP3 (NM_001011709) Human Over-expression Lysate
LS119548 100 µg

PNLIPRP3 (NM_001011709) Human Over-expression Lysate

Sign In for Pricing
View Details
Dog Cytotoxic T-lymphocyte protein 4 ELISA Kit
MBS2886721-01 48 Well

Dog Cytotoxic T-lymphocyte protein 4 ELISA Kit

Sign In for Pricing
View Details
Dog Cytotoxic T-lymphocyte protein 4 ELISA Kit
MBS2886721-02 96 Well

Dog Cytotoxic T-lymphocyte protein 4 ELISA Kit

Sign In for Pricing
View Details
Dog Cytotoxic T-lymphocyte protein 4 ELISA Kit
MBS2886721-03 5x 96 Well

Dog Cytotoxic T-lymphocyte protein 4 ELISA Kit

Sign In for Pricing
View Details
Dog Cytotoxic T-lymphocyte protein 4 ELISA Kit
MBS2886721-04 10x 96 Well

Dog Cytotoxic T-lymphocyte protein 4 ELISA Kit

Sign In for Pricing
View Details
Scyl3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6597408 1.0 µg DNA

Scyl3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details