Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dipk2a Rabbit Polyclonal Antibody (HRP)

Dipk2a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GoP, HASF, GoPro49, 1190002N15Rik

UniProt

Q3USZ8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse 1190002N15Rik

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FLNVKNVYFAQYGEPREGGRRRVVLKRLGSQRELAQLDQSICKRATGRPR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001028317

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1190005I06Rik Mouse Gene Knockout Kit (CRISPR)
KN500036 1 Kit

1190005I06Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Leukotriene B4 Receptor (LTB4R) (NM_001143919) Human Over-expression Lysate
LC428406 20 µg

Leukotriene B4 Receptor (LTB4R) (NM_001143919) Human Over-expression Lysate

Sign In for Pricing
View Details
AKAP13 Antibody
8C10921-AAT 50 µg

AKAP13 Antibody

Sign In for Pricing
View Details
Human AMZ1 activation kit by CRISPRa
GA115912 1 Kit

Human AMZ1 activation kit by CRISPRa

Sign In for Pricing
View Details
RedDotTM2, 200X in DMSO
#40061-T 1x 25 µL

RedDotTM2, 200X in DMSO

Sign In for Pricing
View Details
FGFR3 Human Gene Knockout Kit (CRISPR)
KN215533LP 1 Kit

FGFR3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details