Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C5orf36 Rabbit Polyclonal Antibody (HRP)

C5orf36 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PAPA10, C5orf36

UniProt

Q8IV33

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C5orf36

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_775936

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 N Protein Mouse Monoclonal Antibody [Clone ID: OTI10B2]
CF814437 100 µg

SARS-CoV-2 N Protein Mouse Monoclonal Antibody [Clone ID: OTI10B2]

Sign In for Pricing
View Details
MMP9 (Matrix Metalloproteinase 9) (2C3), CF647 conjugate, 0.1mg/mL
BNC471764-500 1x 500 µL

MMP9 (Matrix Metalloproteinase 9) (2C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human PKC epsilon/PKCE Protein (His Tag)
PKSH032964-01 10 µg

Recombinant Human PKC epsilon/PKCE Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PKC epsilon/PKCE Protein (His Tag)
PKSH032964-02 50 µg

Recombinant Human PKC epsilon/PKCE Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ASS1 Protein (His Tag)
PKSH032092-01 10 µg

Recombinant Human ASS1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ASS1 Protein (His Tag)
PKSH032092-02 50 µg

Recombinant Human ASS1 Protein (His Tag)

Sign In for Pricing
View Details