Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C9orf75 Rabbit Polyclonal Antibody (FITC)

C9orf75 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DFNB79, C9orf75

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C9orf75

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PPFLPAASEEAEPAEGLRVPGLAKNSREYVRPGLPVTFIDEVDSEEAPQA

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_775962

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS709075 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
TPM1 (NM_001018007) Human Over-expression Lysate
LC422690 20 µg

TPM1 (NM_001018007) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS501493 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
PCNA (PC10), CF488A conjugate, 0.1mg/mL
BNC880467-500 1x 500 µL

PCNA (PC10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lauroleic Acid
TRC-L145295-25MG 25 mg

Lauroleic Acid

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS703283 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details