Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBAC2 Rabbit Polyclonal Antibody (HRP)

UBAC2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PHGDHL1

UniProt

Q8NBM4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UBAC2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_808882

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UPRT Mouse Monoclonal Antibody [Clone ID: LBI1A3]
AMM14015V 100 µL

UPRT Mouse Monoclonal Antibody [Clone ID: LBI1A3]

Sign In for Pricing
View Details
Human MutL Homolog 1 (MLH1) ELISA Kit
MBS4501050-01 48 Tests

Human MutL Homolog 1 (MLH1) ELISA Kit

Sign In for Pricing
View Details
Human MutL Homolog 1 (MLH1) ELISA Kit
MBS4501050-02 96 Tests

Human MutL Homolog 1 (MLH1) ELISA Kit

Sign In for Pricing
View Details
Human MutL Homolog 1 (MLH1) ELISA Kit
MBS4501050-03 5x 96 Tests

Human MutL Homolog 1 (MLH1) ELISA Kit

Sign In for Pricing
View Details
Human MutL Homolog 1 (MLH1) ELISA Kit
MBS4501050-04 10x 96 Tests

Human MutL Homolog 1 (MLH1) ELISA Kit

Sign In for Pricing
View Details
FLJ33790 antibody - N-terminal region
MBS3211705-01 0.1 mL

FLJ33790 antibody - N-terminal region

Sign In for Pricing
View Details