Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZDHHC21 Rabbit Polyclonal Antibody (HRP)

ZDHHC21 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DNZ1, DHHC21, DHHC-21, HSPC097

UniProt

Q5RB84

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZDHHC21

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_848661

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD117/c-Kit (Marker for Gastrointestinal Stromal Tumors)
MBS4381041-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

CD117/c-Kit (Marker for Gastrointestinal Stromal Tumors)

Sign In for Pricing
View Details
CD117/c-Kit (Marker for Gastrointestinal Stromal Tumors)
MBS4381041-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

CD117/c-Kit (Marker for Gastrointestinal Stromal Tumors)

Sign In for Pricing
View Details
CD117/c-Kit (Marker for Gastrointestinal Stromal Tumors)
MBS4381041-03 0.1 mg (Without BSA & Azide at 1mg/mL)

CD117/c-Kit (Marker for Gastrointestinal Stromal Tumors)

Sign In for Pricing
View Details
CD117/c-Kit (Marker for Gastrointestinal Stromal Tumors)
MBS4381041-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

CD117/c-Kit (Marker for Gastrointestinal Stromal Tumors)

Sign In for Pricing
View Details
CD117/c-Kit (Marker for Gastrointestinal Stromal Tumors)
MBS4381041-05 5x 0.1 mg (Without BSA & Azide at 1mg/mL)

CD117/c-Kit (Marker for Gastrointestinal Stromal Tumors)

Sign In for Pricing
View Details
Guinea pig Olfactory receptor 5C1 (OR5C1) ELISA Kit
MBS7200444-01 48 Well

Guinea pig Olfactory receptor 5C1 (OR5C1) ELISA Kit

Sign In for Pricing
View Details