Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eras Rabbit Polyclonal Antibody (Biotin)

Eras Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

H, HR, Ha-, ecat, HRAS2, HRasp, ecat5, Ha-Ras2

UniProt

Q7TN89

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LPTKSSILDLSSGTPCTRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_853526

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human NDFIP1 shRNA (UAS) - Lentiviral human NDFIP1 shRNA (UAS, iRFP) (100)
GTR15142755 1 Vial

Lentiviral human NDFIP1 shRNA (UAS) - Lentiviral human NDFIP1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
SLC40A1 3'UTR GFP Stable Cell Line
TU073626 1.0 mL

SLC40A1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Zebrafish AGO4 Rabbit Polyclonal Antibody (Cy3)
orb2805718 100 µg

Zebrafish AGO4 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Lentiviral mouse Foxn3 shRNA (UAS) - Lentiviral mouseFoxn3 shRNA (UAS, GFP) (25)
GTR15159296 1 Vial

Lentiviral mouse Foxn3 shRNA (UAS) - Lentiviral mouseFoxn3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
EWSR1 Rabbit Polyclonal Antibody (Cy3)
orb979291 100 µL

EWSR1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Rabbit Anti-Human IgG (H&L) Antibody (AcalephFluor555)
orb2990418-01 100 µL

Rabbit Anti-Human IgG (H&L) Antibody (AcalephFluor555)

Sign In for Pricing
View Details