Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC37A3 Rabbit Polyclonal Antibody (Biotin)

LRRC37A3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LRRC37, LRRC37A

UniProt

O60309

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LRRC37A3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NYTSTELIIEPEEPSDSSGINLSGFGSEQLDTNDESDVTSTLSYILPYFS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

180kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_955372

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SerpinA3c Protein, Mouse, Recombinant (His Tag)
MBS8122711-01 0.1 mg

SerpinA3c Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
SerpinA3c Protein, Mouse, Recombinant (His Tag)
MBS8122711-02 5x 0.1 mg

SerpinA3c Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
KIT, ID (S746) (KIT, SCFR, Mast/stem cell growth factor receptor Kit, Piebald trait protein, Proto-oncogene c-Kit, Tyrosine-protein kinase Kit, p145 c-kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, CD117) (MaxLight 405) discontinued
037484-ML405 100 µL

KIT, ID (S746) (KIT, SCFR, Mast/stem cell growth factor receptor Kit, Piebald trait protein, Proto-oncogene c-Kit, Tyrosine-protein kinase Kit, p145 c-kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, CD117) (MaxLight 405) discontinued

Sign In for Pricing
View Details
1700015F17Rik Protein Vector (Mouse) (pPB-C-His)
PV146894 500 ng

1700015F17Rik Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Bovine Protein SDA1 homolog, SDAD1 ELISA Kit
MBS9341818-01 48 Well

Bovine Protein SDA1 homolog, SDAD1 ELISA Kit

Sign In for Pricing
View Details
Bovine Protein SDA1 homolog, SDAD1 ELISA Kit
MBS9341818-02 96 Well

Bovine Protein SDA1 homolog, SDAD1 ELISA Kit

Sign In for Pricing
View Details