Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYL4 Rabbit Polyclonal Antibody (Biotin)

MYL4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GT1, ALC1, AMLC, PRO1957

UniProt

P12829

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MYL4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTA

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_001002841

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADD2 Protein Lysate (Mouse) with C-HA Tag
11404034 100 µg

ADD2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
PTEN, Phosphorylated (T383) (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (MaxLight 550)
MBS6338586-01 0.1 mL

PTEN, Phosphorylated (T383) (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (MaxLight 550)

Sign In for Pricing
View Details
PTEN, Phosphorylated (T383) (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (MaxLight 550)
MBS6338586-02 5x 0.1 mL

PTEN, Phosphorylated (T383) (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (MaxLight 550)

Sign In for Pricing
View Details
RAI3 (GPRC5A) (NM_003979) Human Over-expression Lysate
LS009052 100 µg

RAI3 (GPRC5A) (NM_003979) Human Over-expression Lysate

Sign In for Pricing
View Details
LNX3 CRISPR Activation Plasmid (m2)
sc-424960-ACT-2 20 µg

LNX3 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Rabbit Polyclonal CACNA2D3 Antibody
NBP1-30557-0.1mg 0.1 mg

Rabbit Polyclonal CACNA2D3 Antibody

Sign In for Pricing
View Details