Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rap1a Rabbit Polyclonal Antibody (HRP)

Rap1a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

R, Krev, Rap1, G-22K, Krev-1, AI848598

UniProt

P62835

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Rap1a

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_663516

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(5- (4-Fluoro-2-hydroxyphenyl) furan-2-ylmethylene) thiazolidine-2,4-dione, pi 3-K inhibitor xii, aS-252424
NVB22019-01 5000 mg

(5- (4-Fluoro-2-hydroxyphenyl) furan-2-ylmethylene) thiazolidine-2,4-dione, pi 3-K inhibitor xii, aS-252424

Sign In for Pricing
View Details
(5- (4-Fluoro-2-hydroxyphenyl) furan-2-ylmethylene) thiazolidine-2,4-dione, pi 3-K inhibitor xii, aS-252424
NVB22019-02 10000 mg

(5- (4-Fluoro-2-hydroxyphenyl) furan-2-ylmethylene) thiazolidine-2,4-dione, pi 3-K inhibitor xii, aS-252424

Sign In for Pricing
View Details
Human CFP recombinant protein
PX-P6499-100 100 µg

Human CFP recombinant protein

Sign In for Pricing
View Details
YEATS2 Protein Vector (Mouse) (pPM-C-His)
PV247989 500 ng

YEATS2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Fam76b ORF Vector (Rat) (pORF)
ORF066923 1.0 µg DNA

Fam76b ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Cytokeratin 6 (ABT052) Antibody
MBS9527384-01 0.02 mL

Cytokeratin 6 (ABT052) Antibody

Sign In for Pricing
View Details