Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RALGDS Rabbit Polyclonal Antibody (Biotin)

RALGDS Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RGF, RGDS, RalGEF

UniProt

Q6KH11

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RALGDS

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001035827

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf66 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV811587 1.0 µg DNA

C1orf66 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mannose Receptor (Macrophage Mannose Receptor, Macrophage Mannose Receptor 1, MMR, Mannose Receptor C Type 1, MRC1, CD206, CD206 Antigen, CLEC13D) (FITC)
M2256-01D5-01 50 µg

Mannose Receptor (Macrophage Mannose Receptor, Macrophage Mannose Receptor 1, MMR, Mannose Receptor C Type 1, MRC1, CD206, CD206 Antigen, CLEC13D) (FITC)

Sign In for Pricing
View Details
Mannose Receptor (Macrophage Mannose Receptor, Macrophage Mannose Receptor 1, MMR, Mannose Receptor C Type 1, MRC1, CD206, CD206 Antigen, CLEC13D) (FITC)
M2256-01D5-02 100 µg

Mannose Receptor (Macrophage Mannose Receptor, Macrophage Mannose Receptor 1, MMR, Mannose Receptor C Type 1, MRC1, CD206, CD206 Antigen, CLEC13D) (FITC)

Sign In for Pricing
View Details
Mannose Receptor (Macrophage Mannose Receptor, Macrophage Mannose Receptor 1, MMR, Mannose Receptor C Type 1, MRC1, CD206, CD206 Antigen, CLEC13D) (FITC)
M2256-01D5-03 500 µg

Mannose Receptor (Macrophage Mannose Receptor, Macrophage Mannose Receptor 1, MMR, Mannose Receptor C Type 1, MRC1, CD206, CD206 Antigen, CLEC13D) (FITC)

Sign In for Pricing
View Details
IGF1R (Ab-1165/1166) Antibody
CSB-PA142373 100 µL

IGF1R (Ab-1165/1166) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Gbp9 shRNA (UAS) - Lentiviral mouse Gbp9 shRNA (UAS) (25)
GTR15304940 1 Vial

Lentiviral mouse Gbp9 shRNA (UAS) - Lentiviral mouse Gbp9 shRNA (UAS) (25)

Sign In for Pricing
View Details