Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKCG Rabbit Polyclonal Antibody (HRP)

PRKCG Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PKCC, PKCG, SCA14, PKCI (3), PKCgamma, PKC-gamma

UniProt

P05129

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRKCG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

ChIP, WB

NCBI Accession Number

NP_002730

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IBD8 Protein Vector (Human) (pPB-C-His)
PV085205 500 ng

IBD8 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Clcn4-2 3'UTR GFP Stable Cell Line
TU252405 1.0 mL

Clcn4-2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SMAD9 (Mothers Against Decapentaplegic Homolog 9, MAD Homolog 9, Mothers Against DPP Homolog 9, Madh6, SMAD Family Member 9, SMAD 9, Smad9, MADH6, MADH9)
133547 100 µg

SMAD9 (Mothers Against Decapentaplegic Homolog 9, MAD Homolog 9, Mothers Against DPP Homolog 9, Madh6, SMAD Family Member 9, SMAD 9, Smad9, MADH6, MADH9)

Sign In for Pricing
View Details
TSPAN7 Protein Vector (Rat) (pPM-C-HA)
PV313380 500 ng

TSPAN7 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
NME2 (Non-Metastatic Cells 2, Protein (NM23B) Expressed in, MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf) (Biotin)
MBS6171847-01 0.1 mL

NME2 (Non-Metastatic Cells 2, Protein (NM23B) Expressed in, MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf) (Biotin)

Sign In for Pricing
View Details
NME2 (Non-Metastatic Cells 2, Protein (NM23B) Expressed in, MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf) (Biotin)
MBS6171847-02 5x 0.1 mL

NME2 (Non-Metastatic Cells 2, Protein (NM23B) Expressed in, MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf) (Biotin)

Sign In for Pricing
View Details