Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMB4 Rabbit Polyclonal Antibody (HRP)

PSMB4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HN3, HsN3, PRAAS3, PROS26, PROS-26

UniProt

P28070

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PSMB4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002787

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD22 Mouse Monoclonal Antibody (HRP)
orb2608237 100 µg

CD22 Mouse Monoclonal Antibody (HRP)

Sign In for Pricing
View Details
KLHL15 Antibody
orb1554251-01 50 μL

KLHL15 Antibody

Sign In for Pricing
View Details
KLHL15 Antibody
orb1554251-02 100 µL

KLHL15 Antibody

Sign In for Pricing
View Details
KLHL15 Antibody
orb1554251-03 200 µL

KLHL15 Antibody

Sign In for Pricing
View Details
IgG1, Human (C103S, L117F, L118E, P214S, HEK293, His)
HY-P704678 200 µg

IgG1, Human (C103S, L117F, L118E, P214S, HEK293, His)

Sign In for Pricing
View Details
Caprisil C18-TH HPLC Column, 5 µm, 100 Å, CC553-C18-TH x 150 mm
CC553-C18-TH 5 µm

Caprisil C18-TH HPLC Column, 5 µm, 100 Å, CC553-C18-TH x 150 mm

Sign In for Pricing
View Details