Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mapk12 Rabbit Polyclonal Antibody (HRP)

Mapk12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sa, Erk, Erk6, Prkm, P38ga, Sapk3, Prkm12, AW123708, P38gamma

UniProt

O08911

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ERMLVLDAEQRVTAAEALTHPYFESLRDTEDEPKAQKYDDSFDDVDRTLE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_038899

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal BAAT1 Antibody
NBP2-92706-0.02mL 0.02 mL

Rabbit Polyclonal BAAT1 Antibody

Sign In for Pricing
View Details
PTRF, NT (Polymerase I and Transcript Release Factor, Cavin-1, FKSG13) (HRP)
MBS6496038-01 0.2 mL

PTRF, NT (Polymerase I and Transcript Release Factor, Cavin-1, FKSG13) (HRP)

Sign In for Pricing
View Details
PTRF, NT (Polymerase I and Transcript Release Factor, Cavin-1, FKSG13) (HRP)
MBS6496038-02 5x 0.2 mL

PTRF, NT (Polymerase I and Transcript Release Factor, Cavin-1, FKSG13) (HRP)

Sign In for Pricing
View Details
IDI2 Antibody
MBS1495342-01 0.05 mg

IDI2 Antibody

Sign In for Pricing
View Details
IDI2 Antibody
MBS1495342-02 0.1 mg

IDI2 Antibody

Sign In for Pricing
View Details
IDI2 Antibody
MBS1495342-03 5x 0.1 mg

IDI2 Antibody

Sign In for Pricing
View Details