Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pfkfb4 Rabbit Polyclonal Antibody (HRP)

Pfkfb4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C230090D14

UniProt

Q6DTY7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RIECYENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSRIVYYLM

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766607

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Matrix Metalloproteinase 11 (MMP11) ELISA Kit
RD-MMP11-Hu-01 96 Tests

Human Matrix Metalloproteinase 11 (MMP11) ELISA Kit

Sign In for Pricing
View Details
Human Matrix Metalloproteinase 11 (MMP11) ELISA Kit
RD-MMP11-Hu-02 48 Tests

Human Matrix Metalloproteinase 11 (MMP11) ELISA Kit

Sign In for Pricing
View Details
MHC Class 2, RT1B (MHC Class II) (MaxLight 550) discontinued
M3887-67A-ML550 100 µL

MHC Class 2, RT1B (MHC Class II) (MaxLight 550) discontinued

Sign In for Pricing
View Details
CD124/IL4R Human Monoclonal Antibody (FITC)
orb2973906-01 50 Tests

CD124/IL4R Human Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
CD124/IL4R Human Monoclonal Antibody (FITC)
orb2973906-02 100 Tests

CD124/IL4R Human Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Chymase 1, Mast Cell (CMA1)
TRV-0010490-01 10 µg

Recombinant Chymase 1, Mast Cell (CMA1)

Sign In for Pricing
View Details