Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA9 Rabbit Polyclonal Antibody (HRP)

NDUFA9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CC6, CI39k, COQ11, CI-39k, MC1DN26, NDUFS2L, SDR22E1

UniProt

Q16795

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NDUFA9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004993

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SENP8 (NM_001166340) Human Tagged Lenti ORF Clone
RC229692L3 10 µg

SENP8 (NM_001166340) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Immunodeficiency Virus Type 1, p24 (HIV-1 p24) (Biotin)
171599-Biotin 100 µL

Human Immunodeficiency Virus Type 1, p24 (HIV-1 p24) (Biotin)

Sign In for Pricing
View Details
NR1I3 Peptide
orb2018930 100 µg

NR1I3 Peptide

Sign In for Pricing
View Details
Recombinant Shigella Dysenteriae lolB Protein (aa 22-207)
VAng-Lsx06962-50gEcoli 50 µg (E. coli)

Recombinant Shigella Dysenteriae lolB Protein (aa 22-207)

Sign In for Pricing
View Details
SRF Rabbit Polyclonal Antibody
orb11414-01 50 μL

SRF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SRF Rabbit Polyclonal Antibody
orb11414-02 100 µL

SRF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details