Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA9 Rabbit Polyclonal Antibody (HRP)

NDUFA9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CC6, CI39k, COQ11, CI-39k, MC1DN26, NDUFS2L, SDR22E1

UniProt

Q16795

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NDUFA9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004993

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vascular Endothelial Growth Factor 121 (VEGF121) Monoclonal Antibody
CAU34315-01 100 µL

Vascular Endothelial Growth Factor 121 (VEGF121) Monoclonal Antibody

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor 121 (VEGF121) Monoclonal Antibody
CAU34315-02 200 µL

Vascular Endothelial Growth Factor 121 (VEGF121) Monoclonal Antibody

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor 121 (VEGF121) Monoclonal Antibody
CAU34315-03 1 mL

Vascular Endothelial Growth Factor 121 (VEGF121) Monoclonal Antibody

Sign In for Pricing
View Details
CD1A (h) -PR
sc-42744-PR 10 µM - 20 µL

CD1A (h) -PR

Sign In for Pricing
View Details
Recombinant Oryx leucoryx Ribonuclease pancreatic (rnase1)
MBS1445178-01 0.02 mg (E-Coli)

Recombinant Oryx leucoryx Ribonuclease pancreatic (rnase1)

Sign In for Pricing
View Details
Recombinant Oryx leucoryx Ribonuclease pancreatic (rnase1)
MBS1445178-02 0.1 mg (E-Coli)

Recombinant Oryx leucoryx Ribonuclease pancreatic (rnase1)

Sign In for Pricing
View Details